Basic Info.
Model NO.
YH-Exenatide
CAS
141732-76-5
MOQ
1g
Sample
Free
Appearance
White Fine Powder
Test Method
HPLC, Hnmr, LC-Ms, UV, IR
Shelf Life
2 Years
Grade
Pharmaceutical Grade
Function
Anti-Depressant
Application
Capsules, Tablets, Pills
Storage
Keep It in Stored Desiccated Below -18° C
Delivery
7-10days by TNT, FedEx, EMS, DHL
Transport Package
1g/Vial
Specification
99%
Trademark
Yinherb
Origin
China
Production Capacity
500GS Per Month
Product Description
Yinherb Supply 98% pure Exenatida/Exenatide Acetate peptide powder for sale CAS: 141732-76-5
Name:Exenatide Acetate, Exenatida
Cas No:141732-76-5
Formula: C186H286N50O62S
Molecular:4246.62
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Purity:98%
Appearance: white powder
Source: synthetic
Also know as AC 2993, Bydureon, Byetta, Exenatide synthetic, Synthetic exendin-4
Appearance: White Lyophilized Powder
Minimum Order Quantity: 1 g
Brand Name: Yinherb
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C.
What is Exenatide Acetate?
Exendin-4 (exenatide), a 39-amino acid peptide originally isolated from the salivary glands of the Gila monster (Heloderma suspectum), differs from exendin-3 only in two positions close to the N-terminus. Application of exenatide causes an increase in acinar cAMP without stimulating amylase release. As an incretin mimetic, exenatide acts as agonist of the glucagon-like peptide-1 (GLP-1) receptor. As GLP-1, though with prolonged activity, exenatide augments the postprandial production of and suppresses secretion of glucagon. For this reason, exenatide has found use as a medication of diabetes II.
Exenatide Acetate Benefits
1. Exenatide augments pancreas response and more appropriate amount of that helps lower the rise in blood sugar from eating.
2. Exenatide also suppresses pancreatic release of glucagon, which prevents hyperglycemia (high blood sugar levels).
3. Exenatide helps slow down gastric emptying and thus decreases the rate at which meal-derived glucose appears in the bloodstream.
4. Exenatide has a subtle yet prolonged effect to reduce appetite, promote satiety via hypothalamic receptors.
5. Exenatide reduces liver fat content. Fat accumulation in the liver or nonalcoholic fatty liver disease (NAFLD) is strongly related with several metabolic disorders.
Exenatide Acetate Dosage
This depends on your body weight. All of the research carried out so far has used rodent studies, the rats and mice are usually injected with an effective dosage thought to be around 10 μg (mcg) per KG, in humans this is thought to be around the equivalent loading of 1.6 μg per KG in humans, so if you are:
60 KG (132 lb.) then your ideal daily oral dose would be 96 μg (mcg)
70 KG (154 lb.) => 112 μg
80 KG (176 lb.) => 128 μg
90 KG (198 lb.) => 144 μg
Exenatide Acetate HPLC &NMR Test report by Yinherb
Q1: Can i get some samples
A: Yes, we can supply the free sample, but the shipping cost be paid by our customers.
Q2: How to start orders or make payments
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information. Payment by T/T, Western Union or Paypal or Escrow(Alibaba).
Q3: How to confirm the Product Quality before placing orders
A:You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.
Q4:What's your MOQ
A:Our MOQ is 1kg. But usually we accept less quantity such as 100g on the condition that sample charge is 100% paid.
Q5: How about delivery leadtime
A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)
Q6:Is there a discount
A:Different quantity has different discount.
Q7: How do you treat quality complaint
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.